• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » Beta Amyloid Peptides » β-Amyloid (42-1)

β-Amyloid (42-1)

Synonyms βAmyloid; b-Amyloid; bAmyloid; beta-Amyloid; betaAmyloidβ-Amyloid
Description Beta amyloid (42-1) is the reverse of beta amyloid (1-42), the latter is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer's disease (AD) brain.
Sequence
{ALA}{ILE}{VAL}{VAL}{GLY}{GLY}{VAL}{MET}{LEU}{GLY}{ILE}{ILE}
{ALA}{GLY}{LYS}{ASN}{SER}{GLY}{VAL}{ASP}{GLU}{ALA}{PHE}{PHE}
{VAL}{LEU}{LYS}{GLN}{HIS}{HIS}{VAL}{GLU}{TYR}{GLY}{SER}{ASP}
{HIS}{ARG}{PHE}{GLU}{ALA}{ASP}
Sequence Shortening AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Formula C203H311N55O60S1
Molecular Weight 4514.4

Purity > 95%
Gmp Flag 0
Anaspec Cat No Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.
Note


Cat. No.
Product Name
Price
RP11278-0.5
Amylin, human, amide - 0.5 mg
$138.00
RP10017-1
β-Amyloid (1-42), human - 1 mg
$214.00
RP10017-0.5
β-Amyloid (1-42), human - 0.5 mg
$119.00
RP10016-0.5
β-Amyloid (1-40), rat - 0.5 mg
$157.00
RP10013-1
β-Amyloid (1-42), rat - 1 mg
$309.00
RP10013-0.5
β-Amyloid (1-42), rat - 0.5 mg
$176.00
RP10008-5
β-Amyloid (25-35) - 5 mg
$209.00
RP10008-1
β-Amyloid (25-35) - 1 mg
$52.00
RP10004-1
β-Amyloid (1-40) - 1 mg
$190.00
RP10004-0.5
β-Amyloid (1-40) - 0.5 mg
$114.00
RP10002-0.5
β-Amyloid (1-28) - 0.5 mg
$81.00
 
Anderson OA., etc. A2E Induces IL-1ß Production in Retinal Pigment Epithelial Cells via the NLRP3 Inflammasome. PLoS One. 2013 Jun;8(6):e67263.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10034
Size
Price
0.5 mg $285.00
1 mg $475.00