• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » VIP, human, ovine, porcine, rat

VIP, human, ovine, porcine, rat

Description Peptide VIP is a Neuropeptide that is widely distributed in the central and peripheral nervous systems; Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Peptide VIP modulates the activity of many immune system cell types. VIP is a mitogen for embryonic sympathetic neurons and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells.
Cas No 40077-57-4
Sequence
{HIS}{SER}{ASP}{ALA}{VAL}{PHE}{THR}{ASP}{ASN}{TYR}{THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ASN}{SER}{ILE}{LEU}{ASN}-NH2
Sequence Shortening HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Molecular Formula C147H238N44O42S
C Terminal NH2
Molecular Weight 3325.8

Purity > 95%
Solubility Soluble in water (1 mg/ml), colorless
Gmp Flag 0
Anaspec Cat No His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Storage Store at -20°C. Keep tightly closed.
Note

  • VIP, Human, Ovine, Porcine, Rat
  • VIP, Human, Ovine, Porcine, Rat




Notice there is no results found, you can visit "Citations Database" for other results.








For more documents, please visit "Technical Support".

Cat. No. RP10085
Size
Price
0.5 mg $62.00