• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Urocortin III, mouse

Urocortin III, mouse

Synonyms Ucn III; UcnIII; Ucn 3; Ucn3UrocortinIII; Urocortin 3; Urocortin3; LOC498791 Peptide
Description Mouse UcnIII is expressed predominantly in regions of the brain known to be involved in stress-related behaviours, and its expression in the hypothalamus increases following restraint.
Cas No 357952-10-4
Sequence
{PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}{ILE}{MET}{ASN}{ILE}{LEU}{PHE}{ASN}{ILE}{ASP}{LYS}{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{LYS}{ALA}{ALA}{ALA}{ASN}{ALA}{GLN}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
Sequence Shortening FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
Molecular Formula C186H312N52O52S2
C Terminal NH2
Molecular Weight 4172.97

Purity > 95%
Solubility Insoluble in water. Dissolve peptide with 100-200 ml of DMSO then dilute up with desired buffer.
Gmp Flag 0
Storage Store at -20°C
Note


Cat. No.
Product Name
Price
RP10098-0.5
Urocortin II, human - 0.5 mg
$166.00
 
Venkatasubramanian S., etc. Vascular Effects of Urocortins 2 and 3 in Healthy Volunteers. J Am Heart Assoc. 2013 Jan;2(1):e004267.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10101
Size
Price
0.5 mg $166.00