• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » PACAP (1-27), human, ovine, rat

PACAP (1-27), human, ovine, rat

Description PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats. PACAP (1-27) shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), and can stimulate adenylate cyclase much more potently than VIP. The PACAP(1-27)-induced increase in pancreatic venous blood flow was blocked by PACAP(6-27) but not by atropine. Therefore, the endocrine secretagogue effect of PACAP(1-27) is primarily mediated by the PAC(1) receptor, and that PACAP(1-27) may interact with muscarinic receptor function in PACAP-induced insulin and glucagon secretion in the canine pancreas in vivo.
Cas No 127317-03-7
Sequence
{HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}-NH2
Sequence Shortening HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Molecular Formula C142H224N40O39S1
C Terminal NH2
Molecular Weight 3147.62

Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Gmp Flag 0
Anaspec Cat No His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2
Storage Store at -20°C.
Note

  • PACAP (1-27), Human, Ovine, Rat
  • PACAP (1-27), Human, Ovine, Rat


Cat. No.
Product Name
Price
RP10341-0.5
PACAP-Related Peptide (PRP), human - 0.5 mg
$138.00
RP10338-0.5
PACAP (6-38), human, ovine, rat - 0.5 mg
$133.00
RP10335-0.5
PACAP (1-38), human, ovine, rat - 0.5 mg
$142.00
 


Notice there is no results found, you can visit "Citations Database" for other results.








For more documents, please visit "Technical Support".

Cat. No. RP10334
Size
Price
0.5 mg $104.00