• English
  • Sign In
  • Contact Us
×
Catalog Products » PACAP (6-38), human, ovine, rat

PACAP (6-38), human, ovine, rat

Sequence
{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{VAL}{LYS}{ASN}{LYS}-NH2
Sequence Shortening FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Molecular Formula C182H300N56O45S1
C Terminal NH2
Molecular Weight 4024.76

Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Gmp Flag 0
Storage Store the peptide at -20°C.
Note This peptide is a potent agonist.


Cat. No. Product Name Quantity Price
RP10341-0.5
PACAP-Related Peptide (PRP), human - 0.5 mg
$138.00
RP10335-0.5
PACAP (1-38), human, ovine, rat - 0.5 mg
$142.00
RP10334-0.5
PACAP (1-27), human, ovine, rat - 0.5 mg
$104.00
 


You can visit "Citations Database" for more citations.





For more documents, please visit "Technical Support".

Cat. No. RP10338
Size Price
0.5 mg $133.00