• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Peptide YY (PYY) (3-36), human

Peptide YY (PYY) (3-36), human

Description Peptide YY (PYY), a novel 36 amino-acid amidated hormone is a component of the complex neuroendocrine control process. This gut hormone (3-36), when infused into subjects, has been shown to reduce food intake in normal-weight and obese individuals. PYY (3-36) infusion also reduces the plasma levels of the hunger-promoting hormone ghrelin. PYY (3-36) levels have been shown to drop pre-meal and then increase post-prandially. In circulation, PYY (3-36) exists in at least two molecular forms: (1-36) and (3-36). PYY (3-36) selectively binds to Y2 receptors, and it has been found in human intestine and circulating blood.
Cas No 126339-09-1
Sequence
{ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}{ASP}{ALA}{SER}{PRO}{GLU}{GLU}{LEU}{ASN}{ARG}{TYR}{TYR}{ALA}{SER}{LEU}{ARG}{HIS}{TYR}{LEU} {ASN}{LEU}{VAL}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
Sequence Shortening IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Molecular Formula C180H279N53O54
C Terminal NH2
Molecular Weight 4049.48

Purity > 95%
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Gmp Flag 0
Anaspec Cat No Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Storage Store the peptide at -20°C.
Note


Cat. No.
Product Name
Price
RP10355
Peptide YY (PYY), human - 1 mg
$200.00
 
Timothy H Moran, et al. Peptide YY(3–36) inhibits gastric emptying and produces acute reductions in food intake in rhesus monkeys. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2005; 288(2): R384-R388.

Prasanth K Chelikani, et al. Daily, intermittent intravenous infusion of peptide YY(3-36) reduces daily food intake and adiposity in rats. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R298-R305.

Frank H Koegler, et al. Peptide YY(3–36) Inhibits Morning, but Not Evening, Food Intake and Decreases Body Weight in Rhesus Macaques. Diabetes. Nov 2005; 54(11): 3198-3204.

Jennifer M. Rojas., etc. Central Nervous System Neuropeptide Y Signaling Via The Y1 Receptor Partially Dissociates Feeding Behavior From Lipoprotein Metabolism In Lean Rats. Am J Physiol Endocrinol Metab. 2012

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10354
Size
Price
0.5 mg $114.00