• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Growth Hormone Releasing Factor (GHRF) (1-44), human

Growth Hormone Releasing Factor (GHRF) (1-44), human

Synonyms Growth Hormone Releasing FactorGHRF (1-44), human
Description Growth hormone-releasing factor (GHRF) is a hypothalamic peptide which positively regulates the synthesis and secretion of growth hormone in the anterior pituitary. The amino-acid sequence of a 43-residue GHRF peptide isolated from rat hypothalamus was recently determined. Immunocytochemical techniques have been used to localize GHRF-containing cell bodies and nerve fibres largely to the medial-basal region of the rat hypothalamus. The rat has also been used extensively as an animal model to study the effects of GHRF on growth hormone synthesis and secretion and on somatic growth.
Cas No 83930-13-6
Sequence
{TYR}{ALA}{ASP}{ALA}{ILE}{PHE}{THR}{ASN}{SER}{TYR}{ARG}{LYS}{VAL}{LEU}{GLY}{GLN}{LEU}{SER}{ALA}{ARG}{LYS}{LEU}{LEU}{GLN}{ASP}{ILE}{MET}{SER}{ARG}{GLN}{GLN}{GLY}{GLU}{SER}{ASN}{GLN}{GLU}{ARG}{GLY}{ALA}{ARG}{ALA}{ARG}{LEU}-NH2
Sequence Shortening YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular Formula C215H358N72O66S1
C Terminal NH2
Molecular Weight 5039.8

Purity > 95%
Gmp Flag 0
Anaspec Cat No Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
Storage Store at -20°C.
Note




Notice there is no results found, you can visit "Citations Database" for other results.








For more documents, please visit "Technical Support".

Cat. No. RP10734
Size
Price
0.5 mg $142.00