• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » Gastrin-Releasing Peptide, human

Gastrin-Releasing Peptide, human

Description Gastrin-releasing peptide (GRP) is released by the post-ganglionic fibres of the vagus nerve, which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumor marker in the diagnosis of small-cell lung carcinoma.
Cas No 93755-85-2
Sequence
{VAL}{PRO}{LEU}{PRO}{ALA}{GLY}{GLY}{GLY}{THR}{VAL}{LEU}{THR}{LYS}{MET}{TYR}{PRO}{ARG}{GLY}{ASN}{HIS}{TRP}{ALA}{VAL}{GLY}{HIS}{LEU}{MET}-NH2
Sequence Shortening VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Molecular Formula C130H204N38O31S2
C Terminal NH2
Molecular Weight 2859.3

Purity > 95%
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Gmp Flag 0
Anaspec Cat No Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Storage Store the peptide at -20°C. Keep container tightly closed.
Note


Cat. No.
Product Name
Price
RP12740-0.5
Gastrin-1, human - 0.5 mg
$57.00
RP10781-5
Ghrelin, rat - 5 mg
$760.00
RP10781-1
Ghrelin, rat - 1 mg
$190.00
 

Grimsholm O, et al. Levels of gastrin-releasing peptide and substance P in synovial fluid and serum correlate with levels of cytokines in rheumatoid arthritis. Arthritis Res. Ther. 2005; 7(3): R416-426.

Martinez A, et al. Gastrin-releasing peptide (GRP) induces angiogenesis and the specific GRP blocker 77427 inhibits tumor growth in vitro and in vivo. Oncogene. Jun 2005; 24(25): 4106-4113.

Brown TM, et al. Gastrin-releasing peptide promotes suprachiasmatic nuclei cellular rhythmicity in the absence of vasoactive intestinal polypeptide-VPAC2 receptor signaling. J. Neurosci. Nov 2005; 25(48): 11155-11164.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10791
Size
Price
0.5 mg $90.00