Catalog Products » Catalog Peptides » All Catalog Peptides » Gastric Inhibitory Peptide (GIP), human

Gastric Inhibitory Peptide (GIP), human

GIP, also known as gastric inhibitory polypeptide, or glucose-dependent insulinotropic polypeptide, is a 42-amino-acid peptide hormone synthesized in and secreted from K cells in the intestinal epithelium. There are two major GIP molecular forms in circulation, GIP (1-42) and GIP(3-42). Previous studies have demonstrated that GIP (3-42) is a degraded form of GIP (1-42) by the enzyme DPPIV. GIP secretion is primarily regulated by nutrients, especially fat. GIP exhibits potent incretin activity in rodent and human subjects. The primary action of GIP is the stimulation of glucose-dependent insulin secretion. GIP may also play a role in adipocyte biology.
RP10795
$90.00

Ask us a question
Overview
Description GIP, also known as gastric inhibitory polypeptide, or glucose-dependent insulinotropic polypeptide, is a 42-amino-acid peptide hormone synthesized in and secreted from K cells in the intestinal epithelium. There are two major GIP molecular forms in circulation, GIP (1-42) and GIP(3-42). Previous studies have demonstrated that GIP (3-42) is a degraded form of GIP (1-42) by the enzyme DPPIV. GIP secretion is primarily regulated by nutrients, especially fat. GIP exhibits potent incretin activity in rodent and human subjects. The primary action of GIP is the stimulation of glucose-dependent insulin secretion. GIP may also play a role in adipocyte biology.
Cas No 100040-31-1
Sequence
{TYR}{ALA}{GLU}{GLY}{THR}{PHE}{ILE}{SER}{ASP}{TYR}{SER}{ILE}
{ALA}{MET}{ASP}{LYS}{ILE}{HIS}{GLN}{GLN}{ASP}{PHE}{VAL}{ASN}
{TRP}{LEU}{LEU}{ALA}{GLN}{LYS}{GLY}{LYS}{LYS}{ASN}{ASP}{TRP}
{LYS}{HIS}{ASN}{ILE}{THR}{GLN}
Sequence Shortening YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Molecular Formula C226H338N60O66S1
Molecular Weight 4983.6

Properties
Purity > 95%
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Form Lyophilized
Storage Store the peptide at -20°C.

feedback

Do you like the current new website?

Hate

Dislike

Neutral

Like

Love

*