Catalog Products » Catalog Peptide » Galanin, human
Manual
COAs
HPLC
MS

Galanin, human

*This product has been discontinued!*
Galanin is a neuropeptide that has not been established as a member of any known family of neuropeptides despite repeated efforts to discover related peptides. Its actions are mediated via Gi-protein-coupled receptors and ion channels, usually producing inhibition of secretion of a transmitter or hormone in the nervous and endocrine system. In many respects, these inhibitory actions of galanin remind us of those of gamma-aminobutyric acid (GABA) and of neuropeptide Y (NPY). Galanin coexists with GABA, noradrenaline, 5-hydroxytryptamine (5-HT), and NPY in several regions of the brain.
RP10801
Ask us a question
Description Galanin is a neuropeptide that has not been established as a member of any known family of neuropeptides despite repeated efforts to discover related peptides. Its actions are mediated via Gi-protein-coupled receptors and ion channels, usually producing inhibition of secretion of a transmitter or hormone in the nervous and endocrine system. In many respects, these inhibitory actions of galanin remind us of those of gamma-aminobutyric acid (GABA) and of neuropeptide Y (NPY). Galanin coexists with GABA, noradrenaline, 5-hydroxytryptamine (5-HT), and NPY in several regions of the brain.
Cas No 119418-04-1
Sequence
{GLY}{TRP}{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}{LEU}{GLY}
{PRO}{HIS}{ALA}{VAL}{GLY}{ASN}{HIS}{ARG}{SER}{PHE}{SER}{ASP}
{LYS}{ASN}{GLY}{LEU}{THR}{SER}
Sequence Shortening GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Molecular Formula C139H210N42O43
Molecular Weight 3157.41
Back

Purity > 95%
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Form Lyophilized
Storage Store the peptide at -20°C. Keep container tightly closed.
Back