• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Galanin, human

Galanin, human

Description Galanin is a neuropeptide that has not been established as a member of any known family of neuropeptides despite repeated efforts to discover related peptides. Its actions are mediated via Gi-protein-coupled receptors and ion channels, usually producing inhibition of secretion of a transmitter or hormone in the nervous and endocrine system. In many respects, these inhibitory actions of galanin remind us of those of gamma-aminobutyric acid (GABA) and of neuropeptide Y (NPY). Galanin coexists with GABA, noradrenaline, 5-hydroxytryptamine (5-HT), and NPY in several regions of the brain.
Cas No 119418-04-1
Sequence
{GLY}{TRP}{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}{LEU}{GLY}
{PRO}{HIS}{ALA}{VAL}{GLY}{ASN}{HIS}{ARG}{SER}{PHE}{SER}{ASP}
{LYS}{ASN}{GLY}{LEU}{THR}{SER}
Sequence Shortening GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Molecular Formula C139H210N42O43
Molecular Weight 3157.41

Purity > 95%
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Gmp Flag 0
Anaspec Cat No Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser
Storage Store the peptide at -20°C. Keep container tightly closed.
Note

  • Galanin, Human
  • Galanin, Human


Cat. No.
Product Name
Price
RP10804-0.5
Galantide - 0.5 mg
$71.00
 
Merchenthaler I, et al. Estrogen and estrogen receptor-{beta} (ER{beta})-selective ligands induce galanin expression within gonadotropin hormone-releasing hormone-immunoreactive neurons in the female rat brain. Endocrinology. Jun 2005; 146(6): 2760-2765.

Schauble N, et al. Human galanin (GAL) and galanin 1 receptor (GALR1) variations are not involved in fat intake and early onset obesity. J. Nutr. Jun 2005; 135(6): 1387-1392.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10801
Size
Price
0.5 mg $90.00