• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Exendin (9-39)

Exendin (9-39)

Description Exendin (9-39) is an inverse agonist of the murine glucagon-like peptide-1 receptor. There are implications for basal intracellular cyclic adenosine 3', 5'-monophosphate levels and beta-cell glucose competence. Exendin (9-39) is a competitive inhibitor of Exendin-3 and Exendin-4. On digestive smooth muscle, exendin (9-39) behaves as an antagonist for two members of the glucagon-receptor family, GLP-1 and glicentin.
Cas No 133514-43-9
Sequence
{ASP}{LEU}{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}{VAL}{ARG}{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}{GLY}{GLY}{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}{SER}-NH2
Sequence Shortening DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Molecular Formula C149H234N40O47S1
C Terminal NH2
Molecular Weight 3369.76

Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Gmp Flag 0
Anaspec Cat No Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Storage Store the peptide at -20°C.
Note Specific exendin receptor antagonist.


Cat. No.
Product Name
Price
RP10874-0.5
Exendin-4 - 0.5 mg
$147.00
 
Green BD, et al. Chronic treatment with exendin(9-39)amide indicates a minor role for endogenous glucagon-like peptide-1 in metabolic abnormalities of obesity-related diabetes in ob/ob mice. J. Endocrinol. May 2005; 185(2): 307-317.

Ayachi SE, et al. Contraction induced by glicentin on smooth muscle cells from the human colon is abolished by exendin (9-39). Neurogastroenterol. Motil. Apr 2005; 17(2): 302-309.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10872
Size
Price
0.5 mg $138.00