• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » Corticotropin Releasing Factor, human, rat

Corticotropin Releasing Factor, human, rat

Synonyms CRF, human, ratCorticotropin-releasing hormone (CRH)
Description Corticotropin-releasing factor (CRF) has been widely implicated as playing a major role in modulating the endocrine, autonomic, behavioral and immune responses to stress. Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases adrenocorticotropic hormone (ACTH) and endorphin from the anterior pituitary. Corticotropin Releasing Factor (CRF) is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.
Cas No 86784-80-7
Sequence
{SER}{GLU}{GLU}{PRO}{PRO}{ILE}{SER}{LEU}{ASP}{LEU}{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{GLU}{VAL}{LEU}{GLU}{MET}{ALA}{ARG}{ALA}{GLU}{GLN}{LEU}{ALA}{GLN}{GLN}{ALA}{HIS}{SER}{ASN}{ARG}{LYS}{LEU}{MET}{GLU}{ILE}{ILE}-NH2
Sequence Shortening SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Molecular Formula C208H344N60O63S2
C Terminal NH2
Molecular Weight 4757.45

Purity > 95%
Solubility Soluble in water (1 mg/ml), clear and colorless
Gmp Flag 0
Anaspec Cat No Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Storage Store at -20°C
Note


Cat. No.
Product Name
Price
RP11308
Adrenocorticotropic Hormone (ACTH) (4-10), human - 5 mg
$57.00
RP11307-1
Adrenocorticotropic Hormone (ACTH) (18-39), human - 1 mg
$95.00
RP11305-0.5
Adrenocorticotropic Hormone (ACTH) (1-39), rat - 0.5 mg
$90.00
RP11303-0.5
Adrenocorticotropic Hormone (ACTH) (1-24), human - 0.5 mg
$28.00
RP11299
Adrenocorticotropic Hormone (ACTH) (1-10), human - 5 mg
$57.00
RP10983-0.5
Corticotropin Releasing Factor, ovine - 0.5 mg
$109.00
 
Kita I, et al. Corticotropin-releasing factor neurons in the hypothalamic paraventricular nucleus are involved in arousal/yawning response of rats. Behav. Brain Res. Apr 2006; 169(1): 48-56.

Sahuque LL, et al. Anxiogenic and aversive effects of corticotropin-releasing factor (CRF) in the bed nucleus of the stria terminalis in the rat: role of CRF receptor subtypes. Psychopharmacology (Berl.). May 2006; 186(1): 122-132.

Meloni EG, et al. Behavioral and anatomical interactions between dopamine and corticotropin-releasing factor in the rat. J. Neurosci. Apr 2006; 26(14): 3855-3863.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10982
Size
Price
0.5 mg $109.00