• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Corticotropin Releasing Factor, ovine

Corticotropin Releasing Factor, ovine

Synonyms CRFCorticotropin-releasing hormone (CRH)
Description Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases ACTH and endorphin from the anterior pituitary. Corticotropin Releasing Factor is also a neurotransitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.
Cas No 9015-71-8
Sequence
{SER}{GLN}{GLU}{PRO}{PRO}{ILE}{SER}{LEU}{ASP}{LEU}{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{GLU}{VAL}{LEU}{GLU}{MET}{THR}{LYS}{ALA}{ASP}{GLN}{LEU}{ALA}{GLN}{GLN}{ALA}{HIS}{SER}{ASN}{ARG}{LYS}{LEU}{LEU}{ASP}{ILE}{ALA}-NH2
Sequence Shortening SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Molecular Formula C205H339N59O63S1
C Terminal NH2
Molecular Weight 4670.31

Purity > 95%
Solubility Insoluble in water. Dissolve peptide in 60% Acetonitrile with 0.1% TFA solution followed by water or desired buffer.
Gmp Flag 0
Anaspec Cat No Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Storage Store at -20°C. Keep tightly closed. Store with desiccant.
Note Corticotropin Releasing Factor (CRF) analog used to prepare iodinated CRF for receptor studies and immunoassay.


Cat. No.
Product Name
Price
RP10982-0.5
Corticotropin Releasing Factor, human, rat - 0.5 mg
$109.00
 
Adinoff B, et al. Dissection of hypothalamic-pituitary-adrenal axis pathology in 1-month-abstinent alcohol-dependent men, part 2: response to ovine corticotropin-releasing factor and naloxone. Alcohol. Clin. Exp. Res. Apr 2005; 29(4): 528-537.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10983
Size
Price
0.5 mg $109.00