• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Brain Natriuretic Peptide (BNP) (1-32), human

Brain Natriuretic Peptide (BNP) (1-32), human

Synonyms Brain Natriuretic Peptide(1-32), human
Description Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis.
Cas No 114471-18-0
Sequence
{SER}{PRO}{LYS}{MET}{VAL}{GLN}{GLY}{SER}{GLY}{CYS}{PHE}{GLY}
{ARG}{LYS}{MET}{ASP}{ARG}{ILE}{SER}{SER}{SER}{SER}{GLY}{LEU}
{GLY}{CYS}{LYS}{VAL}{LEU}{ARG}{ARG}{HIS}
Sequence Shortening SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Molecular Formula C143H244N50O42S4
Disulfide Bridge Disulfide bridge: Cys10-Cys26
Molecular Weight 3464.1

Purity > 95%
Format Bridge 10-26
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Gmp Flag 0
Anaspec Cat No Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His
Storage Store the peptide at -20°C.
Note

  • Brain Natriuretic Peptide (BNP) (1-32), Human
  • Brain Natriuretic Peptide (BNP) (1-32), Human


Cat. No.
Product Name
Price
RP11927-0.5
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine - 0.5 mg
$95.00
RP11121-0.5
Brain Natriuretic Peptide (BNP) (1-32), rat - 0.5 mg
$109.00
RP11110-0.5
C-Type Natriuretic Peptide (CNP) (1-22), human - 0.5 mg
$86.00
 
Prontera C, et al. Comparison of a fully automated immunoassay with a point-of-care testing method for B-type natriuretic peptide. Clin. Chem. Jul 2005; 51(7): 1274-1276.

Brandt I, et al. Dipeptidyl-peptidase IV converts intact B-type natriuretic peptide into its des-SerPro form. Clin. Chem. Jan 2006; 52(1): 82-87.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP11119
Size
Price
0.5 mg $109.00