• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Brain Natriuretic Peptide (BNP) (1-32), rat

Brain Natriuretic Peptide (BNP) (1-32), rat

Synonyms BNP (1-32), rat
Description Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. BNP is involved in blood pressure control and cardiovascular homeostasis.
Cas No 133448-20-1
Sequence
{ASN}{SER}{LYS}{MET}{ALA}{HIS}{SER}{SER}{SER}{CYS}{PHE}{GLY}
{GLN}{LYS}{ILE}{ASP}{ARG}{ILE}{GLY}{ALA}{VAL}{SER}{ARG}{LEU}
{GLY}{CYS}{ASP}{GLY}{LEU}{ARG}{LEU}{PHE}
Sequence Shortening NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Molecular Formula C146H239N47O44S3
Disulfide Bridge Disulfide bridge: Cys10-Cys26
Molecular Weight 3452.94

Purity > 95%
Format Bridge 10-26
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Gmp Flag 0
Anaspec Cat No Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe
Storage Store at -20°C. Keep tightly closed.
Note


Cat. No.
Product Name
Price
RP11927-0.5
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine - 0.5 mg
$95.00
RP11195-0.5
Atrial Natriuretic Peptide (ANP) (1-28), rat - 0.5 mg
$114.00
RP11119-0.5
Brain Natriuretic Peptide (BNP) (1-32), human - 0.5 mg
$109.00
RP11110-0.5
C-Type Natriuretic Peptide (CNP) (1-22), human - 0.5 mg
$86.00
 
Medvedev A, et al. Natriuretic peptide interaction with [3H]isatin binding sites in rat brain. Brain Res. May 2005; 1042(2): 119-124.

Yu YC, et al. Modulation by brain natriuretic peptide of GABA receptors on rat retinal ON-type bipolar cells. J. Neurosci. Jan 2006; 26(2): 696-707.

Jiang W, et al. Changes in production and metabolism of brain natriuretic peptide in rats with myocardial necrosis. Eur. J. Pharmacol. Jan 2005; 507(1-3): 153-162.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP11121
Size
Price
0.5 mg $109.00