Cecropin B

*This product has been discontinued!*

Cecropins are produced by insects, particularly under conditions of infection. Cecropins are bioactive peptides that interact with membranes and form transmembrane channels that allow the free flow of electrolytes, metabolites, and water across the phospholipid bilayers. Anti-cecropin B is useful for the detection of cecropin B in various immunological assays. Cecropin B has been modified in some instances by substituting a single amino acid to render the molecule less susceptible to proteolytic cleavage.

Cat. No.	RP11225
Size	Buy in bulk

Ask us a question

Overview Properties

Note

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Overview

Cas No	80451-05-4
Sequence	{LYS}{TRP}{LYS}{VAL}{PHE}{LYS}{LYS}{ILE}{GLU}{LYS}{MET}{GLY}{ARG}{ASN}{ILE}{ARG}{ASN}{GLY}{ILE}{VAL}{LYS}{ALA}{GLY}{PRO}{ALA}{ILE}{ALA}{VAL}{LEU}{GLY}{GLU}{ALA}{LYS}{ALA}{LEU}-NH₂
Sequence Shortening	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH₂
Molecular Formula	C₁₇₆H₃₀₂N₅₂O₄₁S₁
C Terminal	NH₂
Molecular Weight	3834.7

Back

Properties

Purity	> 95%
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Storage	The peptide may be stored at 4°C for short period. For long-term storage, store at -20°C. Aliquots remain stable for at least 24 months at -20°C.

Back