• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Amylin (8-37), amide, rat

Amylin (8-37), amide, rat

Synonyms Amylin (8-37), amide; amylin pharmaceuticals; muraglitazar; oxyntomodulin; symlinDiabetes Associated Peptide (8-37), amide
Description Amylin is a 37-aa peptide produced in the pancreatic beta-cell secretory granules and Amylin is co-released with insulin. Amylin has specific binding sites in the CNS and Amylin may regulate gastric emptying and influence carbohydrate metabolism.
Sequence
{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{PRO}{VAL}{LEU}{PRO}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
Sequence Shortening ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Molecular Formula C140H227N43O43
C Terminal NH2
Molecular Weight 3200.6

Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Gmp Flag 0
Anaspec Cat No Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Storage Store at -20°C. Keep tightly closed.
Note


Cat. No.
Product Name
Price
RP13732
Amylin, feline - 0.5 mg
$238.00
RP11293-0.5
Adrenomedullin (AM) (22-52), human - 0.5 mg
$90.00
RP11280-0.5
Amylin, amide, rat - 0.5 mg
$109.00
RP11278-0.5
Amylin, human, amide - 0.5 mg
$138.00
 


Notice there is no results found, you can visit "Citations Database" for other results.








For more documents, please visit "Technical Support".

Cat. No. RP11277
Size
Price
0.5 mg $81.00