• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Amylin, human, amide

Amylin, human, amide

Synonyms Diabetes-Associated Peptide (DAP), amide, humanInsulinoma or islet amyloid polypeptide (IAPP)
Description Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin.
Cas No 122384-88-7
Sequence
{LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{HIS}{SER}{SER}{ASN}{ASN}{PHE}{GLY}{ALA}{ILE}{LEU}{SER}{SER}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
Sequence Shortening KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
Molecular Formula C165H261N51O55S2
C Terminal NH2
Disulfide Bridge Disulfide Bridge: Cys2-Cys7
Molecular Weight 3903.28

Purity > 95%
Format Bridge 2-7
Solubility Can be dissolved in DMSO or DMF first and then dilute with water
Storage Store at -20°C. Keep container tightly closed. Store in a cool dry place.
Note


Cat. No.
Product Name
Price
RP13732
Amylin, feline - 0.5 mg
$238.00
RP11293-0.5
Adrenomedullin (AM) (22-52), human - 0.5 mg
$90.00
RP11280-0.5
Amylin, amide, rat - 0.5 mg
$109.00
RP11277-0.5
Amylin (8-37), amide, rat - 0.5 mg
$81.00
 

Konarkowska B, et al. Thiol reducing compounds prevent human amylin-evoked cytotoxicity. FEBS J. Oct 2005; 272(19): 4949-4959.

Kajava AV, et al. The parallel superpleated beta-structure as a model for amyloid fibrils of human amylin. J. Mol. Biol. Apr 2005; 348(2): 247-252.

Guerreiro LH., etc. Polymeric particles for the controlled release of human amylin. Colloids Surf B Biointerfaces. 2012 Jun;94:101-6.

Kevin Hartman., etc. Bacterial curli protein promotes the conversion of PAP248-286 into the amyloid SEVI: cross-seeding of dissimilar amyloid sequences. PeerJ. 2013 Feb;12(1):e5.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP11278
Size
Price
0.5 mg $138.00