• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Amylin, amide, rat

Amylin, amide, rat

Description Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP), Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach, amylin caused a concentration-dependent decrease in acid secretion. In rat fundic segments, amylin and CGRP each caused a concentration-dependent increase in somatostatin and a decrease in histamine secretion.
Sequence
{LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}
{ALA}{ASN}{PHE}{LEU}{VAL}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}
{PRO}{VAL}{LEU}{PRO}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}
{TYR}
Sequence Shortening KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Molecular Formula C167H272N52O53S2
C Terminal NH2
Disulfide Bridge Disulfide bridge: Cys2-Cys7
Molecular Weight 3920.5

Purity > 95%
Format Bridge 2-7
Solubility Can be dissolved in water directly
Gmp Flag 0
Anaspec Cat No Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Storage Store at -20°C.
Note


Cat. No.
Product Name
Price
RP13732
Amylin, feline - 0.5 mg
$238.00
RP11277-0.5
Amylin (8-37), amide, rat - 0.5 mg
$81.00
 
Stadler M, et al. Increased plasma amylin in type 1 diabetic patients after kidney and pancreas transplantation: A sign of impaired beta-cell function? Diabetes Care. May 2006; 29(5): 1031-1038.

Kairamkonda V, et al. Amylin peptide levels are raised in infants of diabetic mothers. Arch. Dis. Child. Dec 2005; 90(12): 1279-1282.

Takenaka S., etc. Organic Solvent-Tolerant Elastase Efficiently Hydrolyzes Insoluble, Cross-Linked, Protein Fiber Of Eggshell Membranes. Biotechnol Lett. 2012 May;34(5):949-55.

Guerreiro LH., etc. Amylin induces hypoglycemia in mice. An Acad Bras Cienc. 2013 Mar;85(1):349-354.

Guerreiro LH., etc. Preparation and Characterization of PEGylated Amylin. AAPS PharmSciTech. 2013 Sep;14(3):1083-1097.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP11280
Size
Price
0.5 mg $109.00