• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Adrenomedullin (AM) (13-52), human

Adrenomedullin (AM) (13-52), human

Description Adrenomedullin (13-52) is a 40 amino acid peptide with one intramolecular disulfide bridge, Adrenomedullin (13-52) is a high affinity ligand for the adrenomedullin receptor.
Sequence
{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2
Sequence Shortening SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Molecular Formula C200H308N58O59S2
C Terminal NH2
Disulfide Bridge Disulfide bridge: Cys16-Cys21
Molecular Weight 4533.2

Purity > 95%
Format Bridge 16-21
Gmp Flag 0
Storage Store at -20°C.
Note


Cat. No.
Product Name
Price
RP11293-0.5
Adrenomedullin (AM) (22-52), human - 0.5 mg
$90.00
RP11288-0.5
Adrenomedullin (AM) (1-52), human - 0.5 mg
$261.00
 
Tam CW, et al. Enhanced vascular responses to adrenomedullin in mice overexpressing receptor-activity-modifying protein 2. Circ. Res. Feb 2006; 98(2): 262-70.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP11291
Size
Price
0.5 mg $214.00