• English
  • Sign In
  • Contact Us
×
Catalog Products » Adrenomedullin (AM) (22-52), human

Adrenomedullin (AM) (22-52), human

Cas No 159899-65-7
Sequence
{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2
Sequence Shortening TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Molecular Formula C159H252N46O48
C Terminal NH2
Molecular Weight 3576.1

Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Storage Before using, store the peptide in the DRY form at - 20°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Note


Cat. No. Product Name Quantity Price
RP11291-0.5
Adrenomedullin (AM) (13-52), human - 0.5 mg -
RP11288-0.5
Adrenomedullin (AM) (1-52), human - 0.5 mg
$261.00
 
Ross GR, Yallampalli C. Endothelium-Independent Relaxation by Adrenomedullin in Pregnant Rat Mesenteric Artery: Role of cAMP-Dependent Protein Kinase A and Calcium-Activated Potassium Channels. J. Pharmacol. Exp. Ther. Jun 2006; 317(3): 1269-1275.

Hashimoto H, et al. Centrally administered adrenomedullin 2 activates hypothalamic oxytocin-secreting neurons, causing elevated plasma oxytocin level in rats. Am. J. Physiol. Endocrinol. Metab. Nov 2005; 289(5): E753-E761.

You can visit "Citations Database" for more citations.





For more documents, please visit "Technical Support".

Cat. No. RP11293
Size Price
0.5 mg $90.00