• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Adrenocorticotropic Hormone (ACTH) (1-39), rat

Adrenocorticotropic Hormone (ACTH) (1-39), rat

Synonyms ACTH (1-39), ratAdrenocorticotropic hormone, rat
Description Peptide fragments of ACTH (1-39) were formed during in vitro incubation of the peptide with membrane preparations. ACTH (1-39) were isolated by high pressure liquid chromatography, and peptide fragments of ACTH (1-39) characterized by determination of amino acid composition and NH2- terminal residue.
Cas No 77465-10-2
Sequence
{SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}{LYS}{PRO}
{VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}{LYS}{VAL}{TYR}{PRO}
{ASN}{VAL}{ALA}{GLU}{ASN}{GLU}{SER}{ALA}{GLU}{ALA}{PHE}{PRO}
{LEU}{GLU}{PHE}
Sequence Shortening SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
Molecular Formula C210H315N57O57S1
Molecular Weight 4582.5

Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Gmp Flag 0
Storage Before using, store the peptide in the DRY form at 0-5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Note


Mi-Sun Yum., etc. Prenatal stress promotes development of spasms in infant rats. Epilepsia. 2012 Mar;53(3):e46-9.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP11305
Size
Price
0.5 mg $90.00