• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » β-Endorphin, human

β-Endorphin, human

Description Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, b-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-Endorphin is released in response to painful stimuli and b-Endorphin has potent antinociceptive activity mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord.
Cas No 61214-51-5
Sequence
{TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}{GLN}{THR}
{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}
{ASN}{ALA}{TYR}{LYS}{LYS}{GLY}{GLU}
Sequence Shortening YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Molecular Formula C158H251N39O46S1
Molecular Weight 3465.1

Purity > 95%
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Gmp Flag 0
Anaspec Cat No Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu
Storage Store the peptide at -20°C
Note


Kauser S, et al. Modulation of the human hair follicle pigmentary unit by corticotropin-releasing hormone and urocortin peptides. FASEB J. May 2006; 20(7): 882-895.

Bohm M, et al. Detection of functionally active melanocortin receptors and evidence for an immunoregulatory activity of alpha-melanocyte-stimulating hormone in human dermal papilla cells. Endocrinology. Nov 2005; 146(11): 4635-4646.

Kauser S, et al. A fully functional proopiomelanocortin/melanocortin-1 receptor system regulates the differentiation of human scalp hair follicle melanocytes. Endocrinology. Feb 2005; 146(2): 532-543.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP11344
Size
Price
1 mg $71.00