Catalog Products » Catalog Peptide » β-Endorphin, human

β-Endorphin, human

Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, b-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-Endorphin is released in response to painful stimuli and b-Endorphin has potent antinociceptive activity mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord.
RP11344
$71.00

Ask us a question
Overview
Description Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, b-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-Endorphin is released in response to painful stimuli and b-Endorphin has potent antinociceptive activity mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord.
Cas No 61214-51-5
Sequence
{TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}{GLN}{THR}
{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}
{ASN}{ALA}{TYR}{LYS}{LYS}{GLY}{GLU}
Sequence Shortening YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Molecular Formula C158H251N39O46S1
Molecular Weight 3465.1

Properties
Purity > 95%
Solubility Soluble in Ultrapure water under 1mg/ml
Form Lyophilized
Storage Store the peptide at -20°C