• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » Prolactin Releasing Peptide (1-31), human

Prolactin Releasing Peptide (1-31), human

Synonyms PrRP
Sequence
{SER}{ARG}{THR}{HIS}{ARG}{HIS}{SER}{MET}{GLU}{ILE}{ARG}{THR}{PRO}{ASP}{ILE}{ASN}{PRO}{ALA}{TRP}{TYR}{ALA}{SER}{ARG}{GLY}{ILE}{ARG}{PRO}{VAL}{GLY}{ARG}{PHE}-NH2
Sequence Shortening SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
Molecular Formula C160H252N56O42S1
C Terminal NH2
Molecular Weight 3664.15

Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Gmp Flag 0
Storage Store the peptide at -20°C. Keep container tightly closed. Store in a cool dry place.
Note




Notice there is no results found, you can visit "Citations Database" for other results.






For more documents, please visit "Technical Support".

Cat. No. RP11861
Size Price
0.5 mg $190.00