• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Glucagon-Like Peptide (GLP) I (7-37)

Glucagon-Like Peptide (GLP) I (7-37)

Synonyms Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide
Description GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone.
Sequence
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}
{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}
{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}{GLY}
Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Molecular Formula C151H228N40O47
Molecular Weight 3355.68

Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Gmp Flag 0
Anaspec Cat No His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.
Note Potent Insulin secretagogue.

  • Glucagon-Like Peptide (GLP) I (7-37)
  • Glucagon-Like Peptide (GLP) I (7-37)


Cat. No.
Product Name
Price
RP10769-0.5
Glucagon-Like Peptide (GLP) II, human - 0.5 mg
$90.00
 
Schirra J, et al. Endogenous glucagon-like peptide 1 controls endocrine pancreatic secretion and antro-pyloro-duodenal motility in humans. Gut. Feb 2006; 55(2): 243-251.

Cottrell JJ, et al. Glucagon-like peptide-2 protects against TPN-induced intestinal hexose malabsorption in enterally refed piglets. Am. J. Physiol Gastrointest Liver Physiol. Feb 2006; 290(2): G293-G300.

Stephens J, et al. Glucagon-like peptide-2 acutely increases proximal small intestinal blood flow in TPN-fed neonatal piglets. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R283-R289.

Fan H., etc. Molecular mechanism and structural basis of interactions of dipeptidyl peptidase IV with adenosine deaminase and human immunodeficiency virus type-1 transcription transactivator. Eur J Cell Biol.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP12738
Size
Price
0.5 mg $119.00