• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » Calcitonin, eel

Calcitonin, eel

Description Calcitonin is hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Cas No 57014-02-5
Sequence
{CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}{THR}{TYR}{PRO}{ARG}{THR}{ASP}{VAL}{GLY}{ALA}{GLY}{THR}{PRO}-NH2
Sequence Shortening CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2
Molecular Formula C146H241N43O47S2
C Terminal NH2
Disulfide Bridge Disulfide bridge: Cys1-Cys7
Molecular Weight 3414.9

Purity > 95%
Format Bridge 1-7
Anaspec Cat No Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.
Note Calcitonin is A 32 amino acid polypeptide, 8 of which are conserved across all species.

  • Calcitonin, Eel
  • Calcitonin, Eel


Cat. No.
Product Name
Price
RP11099-0.5
Calcitonin, salmon - 0.5 mg
$57.00
RP11095-0.5
Calcitonin Gene Related Peptide (CGRP), rat - 0.5 mg
$128.00
RP11092-0.5
Calcitonin Gene Related Peptide (CGRP) II, rat - 0.5 mg
$119.00
RP11090-0.5
Calcitonin Gene Related Peptide (CGRP) (8-37), rat - 0.5 mg
$90.00
RP11089-0.5
Calcitonin Gene Related Peptide (CGRP) (8-37), human - 0.5 mg
$90.00
 
Supowit SC, et al. Calcitonin gene-related peptide protects against hypertension-induced heart and kidney damage. Hypertension. Jan 2005; 45(1): 109-114.

Bowers MC, et al. Role of calcitonin gene-related peptide in hypertension-induced renal damage. Hypertension. Jul 2005; 46(1): 51-57.

Barbet J, et al. Prognostic impact of serum calcitonin and carcinoembryonic antigen doubling-times in patients with medullary thyroid carcinoma. J. Clin. Endocrinol. Metab. Nov 2005; 90(11): 6077-6084.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP12786
Size
Price
5 mg $451.00