Calcitonin, eel
| RP12786 | |
|
|
|
|
|
|
| Ask us a question | |
IVD Raw Materials
| RP12786 | |
|
|
|
|
|
|
| Ask us a question | |
Calcitonin is hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. |
Calcitonin is A 32 amino acid polypeptide, 8 of which are conserved across all species.
| Cas No | 57014-02-5 |
| Sequence |
{CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}{THR}{TYR}{PRO}{ARG}{THR}{ASP}{VAL}{GLY}{ALA}{GLY}{THR}{PRO}-NH2 |
| Sequence Shortening | CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 |
| Molecular Formula | C146H241N43O47S2 |
| C Terminal | NH2 |
| Disulfide Bridge | Disulfide bridge: Cys1-Cys7 |
| Molecular Weight | 3414.9 |
| Purity | > 95% |
| Format Bridge | 1-7 |
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |