• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » Calmodulin Binding Peptide 1

Calmodulin Binding Peptide 1

Description Removing endogenously bound CaM by titration with a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide) strongly inhibited IP3-induced Ca2+ release. This inhibition was concentration- and time-dependent.
Sequence
{GLY}{VAL}{MET}{PRO}{ARG}{GLU}{GLU}{THR}{ASP}{SER}{LYS}{THR}
{ALA}{SER}{PRO}{TRP}{LYS}{SER}{ALA}{ARG}{LEU}{MET}{VAL}{HIS}
{THR}{VAL}{ALA}{THR}{PHE}{ASN}{SER}{ILE}{LYS}{GLU}{LEU}{ASN}
{GLU}{ARG}{TRP}{ARG}{SER}{LEU}{GLN}{GLN}{LEU}{ALA}
Sequence Shortening GVMPREETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA
Molecular Formula C231H373N69O70S2
Molecular Weight 5301.01

Purity > 95%
Gmp Flag 0
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.
Note

  • Calmodulin Binding Peptide 1
  • Calmodulin Binding Peptide 1


GonzÁlez-Andrade M., et al. Importance of the interaction protein-protein of the CaM-PDE1A and CaM-MLCK complexes in the development of new anti‐CaM drugs. J Mol Recognit. 2013 Apr;26(4):165-74.

N. Dephoure., et al. Hyperplexing: a method for higher-order multiplexed quantitative proteomics provides a map of the dynamic response to rapamycin in yeast. Sci Signal. 2012 Mar;5(217):2.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP13247
Size
Price
0.02 mg $142.00