Calmodulin Binding Peptide 1
| RP13247 | |
|
|
|
|
|
|
| Ask us a question | |
IVD Raw Materials
| RP13247 | |
|
|
|
|
|
|
| Ask us a question | |
Removing endogenously bound CaM by titration with a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide) strongly inhibited IP3-induced Ca2+ release. This inhibition was concentration- and time-dependent. |
| Sequence |
{GLY}{VAL}{MET}{PRO}{ARG}{GLU}{GLU}{THR}{ASP}{SER}{LYS}{THR} {ALA}{SER}{PRO}{TRP}{LYS}{SER}{ALA}{ARG}{LEU}{MET}{VAL}{HIS} {THR}{VAL}{ALA}{THR}{PHE}{ASN}{SER}{ILE}{LYS}{GLU}{LEU}{ASN} {GLU}{ARG}{TRP}{ARG}{SER}{LEU}{GLN}{GLN}{LEU}{ALA} |
| Sequence Shortening | GVMPREETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA |
| Molecular Formula | C231H373N69O70S2 |
| Molecular Weight | 5301.01 |
| Purity | > 95% |
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |