• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » LL37 (Human)

LL37 (Human)

Description The cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity.
Sequence
{LEU}{LEU}{GLY}{ASP}{PHE}{PHE}{ARG}{LYS}{SER}{LYS}{GLU}{LYS}
{ILE}{GLY}{LYS}{GLU}{PHE}{LYS}{ARG}{ILE}{VAL}{GLN}{ARG}{ILE}
{LYS}{ASP}{PHE}{LEU}{ARG}{ASN}{LEU}{VAL}{PRO}{ARG}{THR}{GLU}
{SER}
Sequence Shortening [LL-37, 37 aa]
Molecular Formula C205H340N60O53
Molecular Weight 4493.28

Purity > 95%
Solubility Insoluble in water. Dissolve the peptide in 10% acetonitrile with 0.1% TFA solution. Further dilute with desired buffer.
Gmp Flag 0
Storage Store the product at -20°C. Keep container tightly closed. Store in a cool dry place.
Note


Ouhara K, et al. Susceptibilities of periodontopathogenic and cariogenic bacteria to antibacterial peptides, {beta}-defensins and LL37, produced by human epithelial cells. J. Antimicrob. Chemother. Jun 2005; 55(6): 888-896.

Steinstraesser L, et al. The human host defense peptide LL37/hCAP accelerates angiogenesis in PEGT/PBT biopolymers. Annals of plastic surgery. Jan 2006; 56(1): 93-98.

Huang LC, et al. Multifunctional roles of human cathelicidin (LL-37) at the ocular surface.Invest. Ophthalmol. Vis. Sci. Jun 2006; 47(6): 2369-2380.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP13323
Size
Price
0.2 mg $171.00