• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » β-Endorphin, equine

β-Endorphin, equine

Description Endorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones.
Sequence
{TYR}{GLY}{GLY}{PHE}{MET}{SER}{SER}{GLU}{LYS}{SER}{GLN}{THR}
{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}
{ASN}{ALA}{HIS}{LYS}{LYS}{GLY}{GLN}
Sequence Shortening YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
Molecular Formula C154H248N42O44S1
Molecular Weight 3423.95

Purity > 95%
Gmp Flag 0
Storage Store at -20°C
Note


Cat. No.
Product Name
Price
RP11344
β-Endorphin, human - 1 mg
$71.00
RP11333
N-Acetyl-α-Endorphin - 1 mg
$48.00
 


Notice there is no results found, you can visit "Citations Database" for other results.








For more documents, please visit "Technical Support".

Cat. No. RP13506
Size
Price
0.2 mg $57.00