β-Endorphin, equine
| RP13506 | |
|
|
|
|
|
|
| Ask us a question | |
IVD Raw Materials
| RP13506 | |
|
|
|
|
|
|
| Ask us a question | |
Endorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones. |
| Sequence |
{TYR}{GLY}{GLY}{PHE}{MET}{SER}{SER}{GLU}{LYS}{SER}{GLN}{THR} {PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS} {ASN}{ALA}{HIS}{LYS}{LYS}{GLY}{GLN} |
| Sequence Shortening | YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ |
| Molecular Formula | C154H248N42O44S1 |
| Molecular Weight | 3423.95 |
| Purity | > 95% |
| Storage | Store at -20°C |