Secretoneurin, rat
| RP13702 | |
|
|
|
|
|
|
| Ask us a question | |
IVD Raw Materials
| RP13702 | |
|
|
|
|
|
|
| Ask us a question | |
Secretoneurin (Rat) is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release. |
Secretogranin II
| Sequence |
{THR}{ASN}{GLU}{ILE}{VAL}{GLU}{GLU}{GLN}{TYR}{THR}{PRO}{GLN} {SER}{LEU}{ALA}{THR}{LEU}{GLU}{SER}{VAL}{PHE}{GLN}{GLU}{LEU} {GLY}{LYS}{LEU}{THR}{GLY}{PRO}{SER}{ASN}{GLN} |
| Sequence Shortening | TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ |
| Molecular Formula | C159H252N40O58 |
| Molecular Weight | 3651.95 |
| Purity | > 95% |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
| Storage | Storage at -20°C. Keep tightly closed. |