• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » Secretoneurin, rat

Secretoneurin, rat

Synonyms Secretogranin II
Description Secretoneurin (Rat) is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release.
Sequence
{THR}{ASN}{GLU}{ILE}{VAL}{GLU}{GLU}{GLN}{TYR}{THR}{PRO}{GLN}
{SER}{LEU}{ALA}{THR}{LEU}{GLU}{SER}{VAL}{PHE}{GLN}{GLU}{LEU}
{GLY}{LYS}{LEU}{THR}{GLY}{PRO}{SER}{ASN}{GLN}
Sequence Shortening TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
Molecular Formula C159H252N40O58
Molecular Weight 3651.95

Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Gmp Flag 0
Storage Storage at -20°C. Keep tightly closed.
Note


Troger J, et al. Secretoneurin in the peripheral ocular innervation. Invest. Ophthalmol. Vis. Sci. Feb 2005; 46(2): 647-654.

Fischer-Colbrie R, et al. Secretoneurin: a new player in angiogenesis and chemotaxis linking nerves, blood vessels and the immune system. Curr. Protein Pept. Sci. Aug 2005; 6(4): 373-385.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP13702
Size
Price
0.2 mg $142.00