• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » Beta Amyloid Peptides » β-Amyloid (1-34)

β-Amyloid (1-34)

Synonyms Beta-Amyloid (1-34)
Description This is a fragment of beta-amyloid peptide. It has amino acids 1 through 34.
Sequence
{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}
{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}
{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}
Sequence Shortening DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Molecular Formula C170H253N47O52
Molecular Weight 3787.2

Purity > 95%
Gmp Flag 0
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.
Note




Notice there is no results found, you can visit "Citations Database" for other results.








For more documents, please visit "Technical Support".

Cat. No. RP20140
Size
Price
0.5 mg $130.00