• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » TIP 39, Tuberoinfundibular Neuropeptide

TIP 39, Tuberoinfundibular Neuropeptide

Description This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.
Sequence
{Ser}{Leu}{Ala}{Leu}{Ala}{Asp}{Asp}{Ala}{Ala}{Phe}{Arg}{Glu}
{Arg}{Ala}{Arg}{Leu}{Leu}{Ala}{Ala}{Leu}{Glu}{Arg}{Arg}{His}
{Trp}{Leu}{Asn}{Ser}{Tyr}{Met}{His}{Lys}{Leu}{Leu}{Val}{Leu}
{Asp}{Ala}{Pro}
Sequence Shortening SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Molecular Formula C202H325N61O54S
Molecular Weight 4504.2

Purity > 95%
Gmp Flag 0
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.
Note




Notice there is no results found, you can visit "Citations Database" for other results.








For more documents, please visit "Technical Support".

Cat. No. RP20322
Size
Price
1 mg $245.00