• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » LL-37, scrambled

LL-37, scrambled

Description The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This peptide is the scrambled version.
Sequence
{Gly}{Leu}{Lys}{Leu}{Arg}{Phe}{Glu}{Phe}{Ser}{Lys}{Ile}{Lys}
{Gly}{Glu}{Phe}{Leu}{Lys}{Thr}{Pro}{Glu}{Val}{Arg}{Phe}{Arg}
{Asp}{Ile}{Lys}{Leu}{Lys}{Asp}{Asn}{Arg}{Ile}{Ser}{Val}{Gln}
{Arg}
Sequence Shortening GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Molecular Formula C205H340N60O53
Molecular Weight 4493.3

Purity >95%
Gmp Flag 0
Storage Store at -20°C.
Note


Bandholtz L,Scand J Immunol. 2006 Jun;63(6):410-9.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP20332
Size
Price
1 mg $175.00