• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » Neuropeptide Y(1-36)

Neuropeptide Y(1-36)

Synonyms Neuropeptide Y(1-36)
Description Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.
Sequence
{Tyr}{Pro}{Ser}{Lys}{Pro}{Asp}{Asn}{Pro}{Gly}{Glu}{Asp}{Ala}
{Pro}{Ala}{Glu}{Asp}{Met}{Ala}{Arg}{Tyr}{Tyr}{Ser}{Ala}{Leu}
{Arg}{His}{Tyr}{Ile}{Asn}{Leu}{Ile}{Thr}{Arg}{Gln}{Arg}{Tyr}
Sequence Shortening YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Molecular Formula C189H284N54O58S1
Molecular Weight 4272.7

Purity > 95%
Gmp Flag 0
Storage Store the peptide at -20°C.
Note


Wang F., et al. Reshaping Antibody Diversity. Cell. 2013 Jun;153(6):1379-93.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP20520
Size
Price
1 mg $190.00