Catalog Products » β-Amyloid (1-40)
Manual
COAs
HPLC
MS

β-Amyloid (1-40)

*This product has been discontinued!*
Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.
RP20528
Ask us a question
Description

Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.

Synonyms

amyloid peptide; amyloid beta protein; beta amyloid plaques

Note

This product is a chemically-modified β-amyloid (1-40) precursor, which belongs to GenScript’s "click peptides".The "click peptides" are best described by the following key features:
1. Enhanced Stability—The O-acyl moiety within the click peptide is stable even under acidic pH.
2. Convenient and quick process—The "click peptides" can be easily converted to native peptide at pH 7.4 or above.
3. No by-product formation in the conversion process.
4. High Solubility in water compared to the native peptide.
5. Superior quality—After the "click", the aggregative property of the peptides is significantly minimized compared to its native format.

Sequence
{ASP}{ALA}{GLU}{PHE}{ARG}{HIS}{ASP}{SER}{GLY}{TYR}{GLU}{VAL}
{HIS}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}
{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}
{GLY}{GLY}{VAL}{VAL}
Sequence Shortening DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Formula C194H295N53O58S1
Molecular Weight 4329.82
Back

Purity > 95%
Solubility Insoluble in water, may be dissolved in any buffer of pH >9.
Storage Store at -20°C
Back