Description | This pool includes 28 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire Non-structural protein 7A (Protein ID: P0DTC7) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays. |
Sequence |
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFS TQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKT E |
Purity | Crude |
Solubility | Dissolve in a minimum amount of pure DMSO (approx. 40 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system |
Form | Lyophilized |
Storage | Store at -20°C. |
Note | The peptides of this product are supplied as trifluoroacetate salts |
T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response |
Cat. No. | Product Name | Quantity | Price |
---|---|---|---|
A00170-40 |
DYKDDDDK-tag Antibody, pAb, Rabbit - 40 μg |
$99.00 |
For more documents, please visit "Technical Support".