Catalog Products » SARS-CoV-2 Y14

SARS-CoV-2 Y14

*This product has been discontinued!*
This pool includes 16 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire Uncharacterized protein 14 (Protein ID: P0DTD3) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays.
RP30023
Ask us a question
Overview
Description This pool includes 16 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire Uncharacterized protein 14 (Protein ID: P0DTD3) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays.
Sequence
MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAM
AVMLLLLCCCLTD

Properties
Purity Crude
Solubility Dissolve in a minimum amount of pure DMSO (approx. 40 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system.
Form Lyophilized
Storage Store at -20°C.
Note The peptides of this product are supplied as trifluoroacetate salts

Applications
T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response