Catalog Products » SARS-CoV-2 Spike Glycoprotein B.1.1.7-Alpha

SARS-CoV-2 Spike Glycoprotein B.1.1.7-Alpha

This pool is delivered in two subpools of 158 & 157 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire Spike glycoprotein of SARS-CoV-2 B.1.1.7, UK (Severe Acute Respiratory Syndrome-related coronavirus 2, Lineage B.1.1.7), covering the following mutations: HV 69-70 deletion, Y144 deletion, N501Y, A570D, P681H, T716I, S982A, D1118H and additional mutation D614G.
RP30025
$716.00

Ask us a question
Overview
Description This pool is delivered in two subpools of 158 & 157 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire Spike glycoprotein of SARS-CoV-2 B.1.1.7, UK (Severe Acute Respiratory Syndrome-related coronavirus 2, Lineage B.1.1.7), covering the following mutations: HV 69-70 deletion, Y144 deletion, N501Y, A570D, P681H, T716I, S982A, D1118H and additional mutation D614G. 
Sequence
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS
NVTWFHAISGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNN
ATNVVIKVCEFQFCNDPFLGVYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQ
GNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLA
LHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTL
KSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVA
DYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNY
KLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGV
EGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNF
NGLTGTGVLTESNKKFLPFQQFGRDIDDTTDAVRDPQTLEILDITPCSFGGVSVITPGTN
TSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECD
IPIGAGICASYQTQTNSHRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPINFTISVT
TEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFA
QVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGD
IAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMA
YRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLV
KQLSSNFGAISSVLNDILARLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASAN
LAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICH
DGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTHNTFVSGNCDVVIGIVNNTVYDPLQP
ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL
GKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEP
VLKGVKLHYT

Properties
Source Severe Acute Respiratory Syndrome-related coronavirus 2 (Lineage B.1.1.7) Spike glycoprotein (covering the following mutations: HV 69-70 deletion, Y144 deletion, N501Y, A570D, P681H, T716I, S982A, D1118H and additional mutation D614G).
Gene ID S
Length 1270 aa
Purity Crude (Major peak by ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each individual peptide).
Solubility Dissolve in a minimum amount of pure DMSO (approx. 50 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system.
Form Lyophilized
Storage Store at -20°C.
Note The peptides of this product are supplied as trifluoroacetate salts.

feedback

Do you like the current new website?

Hate

Dislike

Neutral

Like

Love

*