Catalog Products » SARS-CoV-2 Spike Glycoprotein RBD B.1.1.7-Alpha

SARS-CoV-2 Spike Glycoprotein RBD B.1.1.7-Alpha

*This product has been discontinued!*
This pool is delivered in one pool of 53 peptides derived from a peptide scan (15mers with 11 aa overlap) through Spike glycoprotein - Receptor binding domain (mutation: N501Y) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays (e.g. ELISPOT).
RP30026
Ask us a question
Overview
Description This pool is delivered in one pool of 53 peptides derived from a peptide scan (15mers with 11 aa overlap) through Spike glycoprotein - Receptor binding domain (mutation: N501Y) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays (e.g. ELISPOT).
Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK
CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS
NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQ
PTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Properties
Source Severe Acute Respiratory Syndrome-related coronavirus 2 (Lineage B.1.1.7) Spike glycoprotein - Receptor binding domain (covering the following mutation: N501Y).
Gene ID S
Length 223 aa
Purity Crude (Major peak by ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each individual peptide).
Solubility Dissolve in a minimum amount of pure DMSO (approx. 50 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system.
Form Lyophilized
Storage Store at -20°C.
Note The peptides of this product are supplied as trifluoroacetate salts.