• English
  • Sign In
  • Contact Us
×
Catalog Products » SARS-CoV-2 Spike Glycoprotein RBD B.1.617.2-Delta

SARS-CoV-2 Spike Glycoprotein RBD B.1.617.2-Delta

Description This pool is delivered in one pool of 53 peptides derived from a peptide scan through Spike glycoprotein - Receptor binding domain of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2, Lineage B.1.617.2, India, Delta) covering the following mutations: L0452R and T0478K for T cell assays (e.g. ELISPOT).
Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK
CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS
NNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQ
PTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Source Severe Acute Respiratory Syndrome-related coronavirus 2 (Lineage B.1.617.2) Spike glycoprotein - Receptor-binding domain (covering the following mutations: L0452R and T0478K).
Gene ID S
Length 223 aa
Purity Crude (Major peak by ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each individual peptide).
Form Lyophilized
Storage Store at -20°C.
Note The peptides of this product are supplied as trifluoroacetate salts.



Notice there is no results found, you can visit "Citations Database" for other results.






For more documents, please visit "Technical Support".

Cat. No. RP30034
Size Price
1 vial(25µg/peptide) $327.00