[Gly22]-β-Amyloid (1-40), Arctic Mutation
| $115.00 | |
| RP30250-0.5 | |
|
|
|
|
|
|
|
|
|
| Ask us a question | |
IVD Raw Materials
| $115.00 | |
| RP30250-0.5 | |
|
|
|
|
|
|
|
|
|
| Ask us a question | |
| Description | β-Amyloid peptides are the major constituents of senile plaques and neurofibrillary tangles that occur in the hippocampus, neocortex, and amygdala of patients with Alzheimer′s disease. Aβ (1-40) whether soluble or insoluble differentiates AD vs high pathology controls. The Arctic mutation E22G causes early onset of Alzheimer′s compared to wild type and promotes protofibril formation and neurotoxicity. |
| Sequence |
{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val} {His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Gly}{Asp}{Val} {Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val} {Gly}{Gly}{Val}{Val} |
| Sequence Shortening | DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV |
| Molecular Weight | 4257.76 |
| Purity | >95% |
| Solubility | Soluble in Formic acid under 1mg/ml |
| Form | Lyophilized |
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.