• English
  • Sign In
  • Contact Us
×
Catalog Products » Recombinant Proteins » Other Catalog Proteins » Histone H3, His, Human

Histone H3, His, Human

Synonyms Histone H3, human;
Description Recombinant protein, full-length, expressed in E.coli and purified using FPLC. Purity 90% by SDS-PAGE and Commassie blue staining. Accession No. NP_003520.
Species Human
Source E. coli
Sequence
HHHHHHDDDDKMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAL
REIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTN
LCAIHAKRVTIMPKDIQLARRIRGERA

Molecular Weight Theoretical M.W.=16.8 kDa
Formulation 100 µg of human histone H3 quanti- tated using the molar absorption coefficient (276 nm) of 4640. Lyophilized powder; reconstitute in sterile water or buffer of choice.
Storage Stable for 2 years at 4°C from date of shipment. Once rehydrated, aliquot and store at -20°C.
Note For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.




Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z02527
Size Price
100 ug $195.00