×
Catalog Products » Recombinant Proteins » Cytokines » Interleukin-17 Receptor C (IL-17 RC), His, Mouse

IL-17 RC, His, Mouse

Synonyms IL-17 RL
Description Interleukin-17 receptor C (IL-17RC) , also known as interleukin-17 receptor–like (IL-17RL), forms a heterodimeric complex with IL-17RA to engage IL-17 ligand and promote IL-17 signaling. IL-17RC has 22% sequence homology with IL-17RA and is highly expressed in epithelial cells. IL-17RC can undergo alternative splicing generating several different variants, some of which a function has yet to be defined. High expression of IL-17RC has been detected in prostate cancer cells, however, IL-17 signaling has also been show to promote anti-tumor activity in certain types of cancer. Due to IL-17’s role in inflammation, IL-17RC has been indicated as having a potential role in certain autoimmune disease.
Recombinant mouse IL-17RC produced in CHO cells is a polypeptide chain containing 451 amino acids. A fully biologically active molecule, rmIL-17RC has a molecular mass of 58 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Accession No Q8K4C2-2
Source CHO
Specific Activity ED50 < 2 μg /ml, measured in a cell proliferation assay using wt MEF cells.
Sequence
LERLMEPQDTARCSLGLSCH LWDGDVLCLPGSLQSAPGPVLVPTRLQTEL VLRCPQKTDCALCVRVVVHLAVHGHWAEPE EAGKSDSELQ
ESRNASLQAQ VVLSFQAYPI ARCALLEVQV PADLVQPGQS
VGSAVFDCFE ASLGAEVQIW SYTKPRYQKE LNLTQQLPDC
RGLEVRDSIQSCWVLPWLNV STDGDNVLLT LDVSEEQDFS FLLYLRPVPD
ALKSLWYKNLTGPQNITLNHTDLVPCLCIQ VWSLEPDSER VEFCPFREDP GAHRNLWHIA
RLRVLSPGVW QLDAPCCLPG KVTLCWQAPD QSPCQPLVPP
VPQKNATVNE PQDFQLVAGH PNLCVQVSTW EKVQLQACLW
ADSLGPFKDD MLLVEMKTGL NNTSVCALEPSGCTPLPSMASTRAARLGEE LLQDFRSHQCMQLWNDDNMG
SLWACPMDKY IHRRWHHHHH H

Measured Molecular Weight 58 kDa, observed by reducing SDS-PAGE.
Purity > 95% as analyzed by SDS-PAGE.
Formulation Lyophilized from a 0.2 μm filtered solution in PBS.
Reconstitution Reconstituted in ddH2O or PBS at 100 μg/ml.
Endotoxin Level < 0.2 EU/μg, determined by LAL method.
Storage Lyophilized recombinant Mouse Interleukin-17 C Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse Interleukin-17C Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.
Note For research use only




Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z03329
Size
Price
50 ug $145.00
10 ug $59.00
*
*
*
*