• English
  • Sign In
  • Contact Us
×
Catalog Products » Recombinant Proteins » TIM-3 Fc Chimera, Human

TIM-3 Fc Chimera, Human

TIM-3 Fc Chimera, Human

Immobilized Galectin-9 His,Human at 0.5μg/mL (100 μL/well) can bind TIM-3 Fc,Human with a linear range of 0.78-6.25 μg/mL.

TIM-3 Fc Chimera, Human

Measured by its binding ability in a functional ELISA. Immobilized recombinant human TIM-3 at 500 ng/mL, the concentration of Anti-TIM3 mouse antibody (Genscript) that produces 50% optimal binding response is found to be approximately 5 ng/mL.

Synonyms T Cell Immunoglobulin Mucin-3; TIM-3
Description T cell Ig- and mucin-domain-containing molecules (TIMs) are a family of transmembrane proteins expressed by various immune cells. TIM-3 is an inhibitory molecule that is induced following T cell activation. TIM-3 is expressed by exhausted T cells in the settings of chronic infection and cancer, and tumor-infiltrating T cells that co-express PD-1 and TIM-3 exhibit the most severe exhausted phenotype. Tumor-infiltrating dendritic cells also express TIM-3. TIM-3 expression on DCs was found to suppress innate immunity by reducing the immunogenicity of nucleic acids released by dying tumor cells. Research studies show that heterodimerization of TIM-3 with CEACAM-1 is critical for the inhibitory function of TIM-3, and co-blockade of TIM-3 and CEACAM-1 enhanced antitumor responses in a mouse model of colorectal cancer. Its binding to Galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. TIM-3 ligation attenuates CD8+ and Th1 cell responses and promotes the activity of Treg and myeloid derived suppressor cells. In addition, dendritic cell-expressed TIM-3 dampens inflammation by enabling the phagocytosis of apoptotic cells and the cross-presentation of apoptotic cell antigens.
Recombinant Human TIM-3 Fc Chimera produced in HEK293 cells is a polypeptide chain containing 412 amino acids with the C-terminal human IgG1 Fc fragment. A fully biologically active molecule, rhTIM-3 has a molecular mass of 60-65 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Recombinant Human EGF-R/ErbB1 Fc Chimera produced in CHO cells is a polypeptide chain containing 854 amino acids with the C-termimal human IgG1 Fc fragment. A fully biologically active molecule, rhEGF-R/ErbB1 has a molecular mass of 12-125 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Accession No Q8TDQ0
Source HEK293
Biological Activity Activity1: Immobilized TIM-3 Fc Chimera, Human at 0.5μg/mL, the concentration of Anti-TIM3 mouse antibody (Genscript) that produces 50% optimal binding response is found to be approximately 5 ng/mL.
Activity2: Immobilized Galectin-9,His, Human at 0.5μg/mL (100 μL/well) can bind TIM-3 Fc Chimera, Human with a linear range of 0.78-6.25 μg/mL.
Sequence
SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPV
FECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIEN
VTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAP
TRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQIS
TLANELRDSRLANDLRDSGATIR

Measured Molecular Weight 60-65 kDa, observed by reducing SDS-PAGE.
Purity > 95% as analyzed by reducing SDS-PAGE.
Formulation Lyophilized from a 0.2 μm filtered solution in PBS.
Reconstitution Reconstituted in ddH₂O or PBS at 100 μg/ml.
Endotoxin Level < 0.2 EU/μg, determined by LAL method.
Storage Lyophilized recombinant Human TIM-3 remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution, Human TIM-3 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.

  • TIM-3 Fc Chimera, Human
  • TIM-3 Fc Chimera, Human

    Immobilized Galectin-9 His,Human at 0.5μg/mL (100 μL/well) can bind TIM-3 Fc,Human with a linear range of 0.78-6.25 μg/mL.

  • TIM-3 Fc Chimera, Human
  • TIM-3 Fc Chimera, Human

    Measured by its binding ability in a functional ELISA. Immobilized recombinant human TIM-3 at 500 ng/mL, the concentration of Anti-TIM3 mouse antibody (Genscript) that produces 50% optimal binding response is found to be approximately 5 ng/mL.


Cat. No.
Product Name
Price
A01835-40
Human TIM3 Antibody (TI.H3), mAb, Mouse - 40 ug
$99.00
A01834-40
Human TIM3 Antibody (TI.B2), mAb, Mouse - 40 ug
$99.00
 


Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z03392
Size
Price
50 ug $275.00
1 mg $1500.00