• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » CD19 Fc Chimera, Human

CD19 Fc Chimera, Human

Synonyms CD19; Leu-12; B4; B-lymphocyte antigen
Description CD19 is a 95 kDa coreceptor, which amplifies the signaling cascade in B cells. On the B cell surface, CD19 associates with CD21, CD81 and Leu-13 to exert its function. The cytoplasmic tail of CD19 has nine conserved tyrosine residues playing critical roles in CD19 mediated function by coupling signaling molecules to the receptor. Mature human CD19 consists of a 272aa extracellular domain (ECD) with two Ig-like domains, a 22aa transmembrane segment, and a 243aa cytoplasmic domain.
Recombinant Human CD19 Fc Chimera produced in CHO cells is a polypeptide chain containing 505 amino acids with the C-terminal human IgG1 Fc fragment. A fully biologically active molecule, rhCD19 a molecular mass of 62 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Accession No P15391
Source CHO
Sequence
PEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPL
KPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLC
QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGL
KNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLP
PRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSW
THVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATA
QDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWK

Measured Molecular Weight 62 kDa, observed by reducing SDS-PAGE.
Purity > 95% as analyzed by reducing SDS-PAGE.
Formulation Lyophilized from a 0.2 μm filtered solution in PBS.
Reconstitution Reconstituted in ddH₂O or PBS at 100 μg/ml.
Endotoxin Level < 0.2 EU/μg, determined by LAL method.
Storage Lyophilized recombinant CD19 Fc Chimera, Human remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution, Human CD19 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.




Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z03407
Size
Price
50 ug $275.00
1 mg $1500.00