• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » PD-1, His, Human

PD-1, His, Human

PD-1, His, Human

Immobilized PD-1,His, Human at 2 μg/mL can bind PD-L1 Fc Chimera, Human(Cat.No.Z03371) with a linear range of 24-390ng/mL.

PD-1, His, Human

Immobilized PD-1,His, Human at 0.5 μg/mL can bind Keytruda(Merck) with a linear range of 0.017~1.37ng/mL.

Synonyms PD-1; CD279; PDCD1
Description Programmed death (PD-1) is an immunoinhibitory receptor that belongs to the CD28 family and is expressed on T cells, B cells, monocytes, natural killer cells, and many tumor-infiltrating lymphocytes (TILs); PD-1 is a type I membrane protein of 268 amino acids and which structure includes an extracellular IgV domain followed by a transmembrane region and an intracellular tail. The intracellular tail contains two phosphorylation sites located in an immunoreceptor tyrosine-based inhibitory motif and an immunoreceptor tyrosine-based switch motif, which suggests that PD-1 negatively regulates TCR signals. This is consistent with binding of SHP-1 and SHP-2 phosphatases to the cytoplasmic tail of PD-1 upon ligand binding. It has 2 ligands that have been described PD-L1(B7H1) and PD-L2(B7-DC); PD-1 induction on activated T cells occurs in response to PD-L1 or L2 engagement and limits effector T-cell activity in peripheral organs and tissues during inflammation, thus preventing autoimmunity.
Recombinant Human PD-1 produced in HEK293 cells is a polypeptide chain containing 149 amino acids with C-terminal 6×His. A fully biologically active molecule, rhPD-1 has a molecular mass of 30-40 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Source HEK293
Biological Activity Immobilized PD-1,His, Human at 2 μg/mL can bind PD-L1 Fc Chimera, Human(Z03371) with a linear range of 24-390ng/mL.
Immobilized PD-1,His, Human at 0.5 μg/mL can bind Keytruda(Merck) with a linear range of 0.017~1.37ng/mL.
Sequence
Leu²⁵-Gln¹⁶⁷ (Accession #: Q15116), expressed with a C-terminal 6xHis
LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESF
VLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPN
GRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAE
LRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Measured Molecular Weight 30-40 kDa, observed by reducing SDS-PAGE.
Purity >95% as analyzed by reducing SDS-PAGE.
Formulation Lyophilized from a 0.2 μm filtered solution in PBS, 5% trehalose and mannitol.
Reconstitution Reconstituted in ddH₂O or PBS at 100 μg/ml.
Endotoxin Level < 0.2 EU/μg, determined by LAL method.
Storage Lyophilized recombinant PD-1 remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution, Human PD-1 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.

  • PD-1, His, Human
  • PD-1, His, Human

    Immobilized PD-1,His, Human at 2 μg/mL can bind PD-L1 Fc Chimera, Human(Cat.No.Z03371) with a linear range of 24-390ng/mL.

  • PD-1, His, Human
  • PD-1, His, Human

    Immobilized PD-1,His, Human at 0.5 μg/mL can bind Keytruda(Merck) with a linear range of 0.017~1.37ng/mL.




Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z03424
Size
Price
100 μg $200.00
1 mg $1500.00