Synonyms | PD-1; CD279; PDCD1; Programmed Death-1; PD-L1; B7-H1; CD274; PDCD1L1; PDCD1LG1; B7 Homolog 1,human pd-l1,pdl1 |
Description | Programmed death-ligand 1 (PD-L1) also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) is a protein that in humans is encoded by the CD274 gene. PD-L1((B7-H1)) is a 40kDa type 1 transmembrane protein that has been speculated to play a major role in suppressing the immune system during particular events such as pregnancy, tissue allografts, autoimmune disease and other disease states such as hepatitis. Normally the immune system reacts to foreign antigens where there is some accumulation in the lymph nodes or spleen which triggers a proliferation of antigen-specific CD8+ T cell. PD-L1(B7-H1) binds to its receptor, PD-1, found on activated T cells, B cells, and myeloid cells, to modulate activation or inhibition. PD-L1(B7-H1) expression is up‑regulated in a small fraction of activated T and B cells and a much larger fraction of activated monocytes. PD-L1(B7-H1) expression is also induced in dendritic cells and keratinocytes after IFN-gamma stimulation. Interaction of B7-H1 with PD-1 results in inhibition of TCR-mediated proliferation and cytokine production. Recombinant Human PD-L1 produced in HEK293 cells is a polypeptide chain containing 227 amino acids with C-terminal 6×His. A fully biologically active molecule, rhPD-L1 has a molecular mass of 31-35 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Source | HEK293 |
Biological Activity | Immobilized PD-L1, His, Human at 2 μg/mL (100 μl/well) can bind PD-1 Fc Chimera, Human(Cat: Z03370) with a linear range of 24-390 ng/mL. |
Sequence | Phe¹⁹-Thr²³⁹ (Accession #: Q9NZQ7-1), expressed with a C-terminal 6xHis FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYW EMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGN AALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYN KINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQV LSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRR LDPEENHTAELVIPELPLAHPPNERTHHHHHH |
Measured Molecular Weight | 31-35 kDa, observed by reducing SDS-PAGE. |
Purity | >95% as analyzed by reducing SDS-PAGE. |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS, 5% trehalose and mannitol. |
Reconstitution | Reconstituted in ddH₂O or PBS at 100 μg/ml. |
Endotoxin Level | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant PD-L1 remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution, Human PD-L1 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles. |
For more documents, please visit "Technical Support".