• English
  • Sign In
  • Contact Us
×
Catalog Products » Recombinant Proteins » Growth Factors » Transforming Growth Factor β-2, Human

TGF-β 2, Human

Synonyms Transforming growth factor beta-2, TGFB2, Polyergin, G-TSF,Glioblastoma-derived T-cell suppressor factor,Cetermin,BSC-1 cell growth inhibitor,TGF-beta-2
Description Transforming growth factor beta-2 (TGF-β2) is a secreted protein which belongs to the TGF-beta family. It is known as a cytokine that performs many cellular functions and has a vital role during embryonic development. The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD).
Recombinant human TGF-β2 produced by a mammalian expression system is a polypeptide chain containing 112 amino acids. A fully biologically active molecule; rh TGF-β2 a molecular mass of 12.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Source Human Cells
Biological Activity ED50 <0.2 ng/ml, measured in a cell proliferation assay using mouse HT-2 cells.
Sequence
Ala³⁰³-Ser⁴¹⁴ (Accession #:P61812);
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH
EPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTI
NPEASASPCCVSQDLEPLTILYYIGKTPKIEQLS
NMIVKSCKCS

Measured Molecular Weight 12.7 kDa; observed by reducing SDS-PAGE.
Purity > 95% as analyzed by SDS-PAGE.
Formulation Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.
Reconstitution Reconstituted in ddH₂O at 100 μg/ml.
Endotoxin Level < 1 EU/μg; determined by LAL method.
Storage Lyophilized recombinant TGF-β2, human remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution; Human TGF-β2 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.




Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z03429
Size
Price
10 µg $195.00
50 µg $550.00
1 mg $3000.00