• English
  • Sign In
  • Contact Us
×
Catalog Products » Recombinant Proteins » Growth Factors » Transforming Growth Factor β-1, Mouse

TGF-β 1, Mouse

Synonyms TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP;latency-associated peptide; TGFbeta; TGF-beta 1 protein; transforming growth factor beta-1
Description Transforming growth factor beta 1 (TGFβ1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF-β1, TGF-β2 and TGF-β3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF-β receptor type II (TβR-II), and a TGF-β receptor type I (TβR-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF-β expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, hematopoietic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.
Recombinant Mouse TGF-β1 produced by a mammalian expression system is a polypeptide chain containing 112 amino acids. A fully biologically active molecule; rm TGF-β1 a molecular mass of 12.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Source Human Cells
Biological Activity ED50 <0.2 ng/ml, measured in a cell proliferation assay using mouse HT-2 cells.
Sequence
Ala²⁷⁹-Ser³⁹⁰ (Accession #:P04202);
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIH
EPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQH
NPGASASPCCVPQALEPLPIVYYVGRKPKVEQLS
NMIVRSCKCS

Measured Molecular Weight 12.8 kDa; observed by reducing SDS-PAGE.
Purity > 95% as analyzed by SDS-PAGE.
Formulation Lyophilized from a 0.2 μm filtered solution in of 4 mM HCl.
Reconstitution Reconstituted in ddH₂O at 100 μg/ml.
Endotoxin Level < 1 EU/μg; determined by LAL method.
Storage Lyophilized recombinant TGF-β1, Mouse remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution; Mouse TGF-β1 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.




Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z03431
Size
Price
10 µg $195.00
50 µg $550.00
1 mg $3000.00